SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386041893|ref|YP_005960847.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386041893|ref|YP_005960847.1|
Domain Number 1 Region: 429-557
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000000219
Family Histidine kinase 0.024
Further Details:      
 
Domain Number 2 Region: 312-360
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000012
Family HAMP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386041893|ref|YP_005960847.1|
Sequence length 606
Comment histidine kinase,histidine kinase, HAMP region [Paenibacillus polymyxa M1]
Sequence
MFKFNFYTKIVSIVIVLLIPVLLLYVYSNQTTTGVLREELNQSNYNQLTFFQNQVNTNIE
MISSWPHLLIHDPDVASFQAIFLKDKTLNLDGINLVKRIQTKLGLQESSSNWRTGLSIYS
PSLGRVVSENGASYYDQKVLNQSITNGWQVSKKRVYGKDQFIFSLYTLSPFSSLANPETA
NTIIKVEFDSSNIQDMLDRFKGDGRKEPFYYKKGVGVIYNRSANAELSSQLIAKLEKLGL
HEVDNLTVKIGEESYLVHAVLSQTTGWYLIDYMPLSDMMSPIYSSNRLFYITVVGSLLVG
IIGAYLLHSQVQVPILQLVRAFRRLKDGDYAVRLSPKGSHEFAFLSRQFNLMVEQIQELF
EKVYVEKLHVKEARLKQLQSQINPHFFYNCFSFITSMAKLRNHEAVVAMAHNLSKYYRYT
TRQERDLVPLSDEVEFVQYYLKIQQMRMPRLTFTIDISSQANPLLVPPLVLQPLVENAVL
HGIEPQAEEGIIRIMTECVGSSMYLIVDDNGLGLSDEGITSLTLALEKPVEEKSGYGLWN
VHQRMRLHFGENAGLEFSLSPLGGLRVILKWTLSIEEGQEDGLIHSSSNSRNSKLEDTDG
SDITSG
Download sequence
Identical sequences E3E8E0
WP_013371918.1.14980 WP_013371918.1.91857 gi|310642815|ref|YP_003947573.1| gi|386041893|ref|YP_005960847.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]