SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|507716688|ref|YP_008049297.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507716688|ref|YP_008049297.1|
Domain Number 1 Region: 299-453
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-28
Family Histidine kinase 0.0068
Further Details:      
 
Domain Number 2 Region: 230-308
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000275
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|507716688|ref|YP_008049297.1|
Domain Number - Region: 193-242
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00497
Family HAMP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507716688|ref|YP_008049297.1|
Sequence length 459
Comment two-component sensor histidine kinase [Paenibacillus polymyxa M1]
Sequence
MRTMRAKILLSLSIAMLITVCITVVLFIRLIDDILVNQAKSKLHEQARKAVHIMSDGGFD
RLDNAELNYVIKGVLLSADYFILSTDNRIIDSSVSGMEGKKLERLLLTRQGFFASVHPSA
HDLVTTHEGVAVLQGKKILFTNEELPGQPFRIFVYSPLSSLRALYVPLMRTTLLSIVASF
LVILVIGLMVVSRLVRPLKRLKEAVGNYEPNQPQDSDFPQADKSEIGELIGTFHSMSARI
QQHHHSQIEFLQNVSHELRTPLMSIQGYVYAIQDQVVSQDEGLSIIKVQSQRLIDMVEKL
LQLSRLEALNEEWPVSLIDLRSMAEDAVHLLMPMASERSISLRVEGEGLHVAVPAEQLFR
MILNLLQNAVRHTSTEVVIHLETGTTPEVVWVMHVDDDGEGLTESEAAEVFGRFYTGSNG
ATGLGLAICRQIASRLNGELLCTRSPLGGARFSYIQRMS
Download sequence
Identical sequences E3E5Q2
gi|507716688|ref|YP_008049297.1| gi|310643412|ref|YP_003948170.1| WP_013372508.1.13814 WP_013372508.1.14980 WP_013372508.1.31500 WP_013372508.1.91857 WP_013372508.1.99789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]