SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|507717481|ref|YP_008050090.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717481|ref|YP_008050090.1|
Domain Number 1 Region: 805-1105
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.3e-62
Family beta-glycanases 0.00029
Further Details:      
 
Domain Number 2 Region: 1220-1370
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.73e-49
Family Cellulose-binding domain family III 0.0000215
Further Details:      
 
Domain Number 3 Region: 87-474
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.93e-25
Family beta-glycanases 0.052
Further Details:      
 
Domain Number 4 Region: 592-672,1115-1203
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-16
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 5 Region: 672-792
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000935
Family Family 6 carbohydrate binding module, CBM6 0.084
Further Details:      
 
Domain Number 6 Region: 471-568
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000384
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|507717481|ref|YP_008050090.1|
Sequence length 1373
Comment glycoside hydrolase family protein [Paenibacillus polymyxa M1]
Sequence
MERHSYGVLLFSNVKEESGMRAKNSSNLLFKRSKWLPVVMACTMIVGGALPAPTVVHGQT
AKTITIKVDTSKDRKPISPYIYGTNQDLAGDENMAARRLGGNRMTGYNWENNMSNAGSDW
QQSSDNFLCNNGGLTGSECEKPGAVTTSFHDQSLKLGAYSLVTLPMAGYVAKDGNGSVQE
SEKAPSARWNQVVNAKNAPFQLQPDLNDNRVYADEFVHFLVNKYGAASTKTGVKGYALDN
EPALWSHTHPRIHGEKVGAKELVDRSVSLSKAVKAVDAGAEIFGPVLYGFGAYKDLQTAP
DWDSVKGSYSWFVDYYLDQMRLSSQAEGKRLLDVFDVHWYPEAMGGGIRITNEVGNDETK
QARMQAPRTLWDPTYKEDSWIAQWNSEFLPILPRLKQSVDKYYPGTKLAMTEYSYGGEND
ISGGIAMADVLGILGKNDVYMANYWKLQDGANNYVNAAYKLYRNYDGKSSTFGNTSVSAK
TSDIVNSSVHASITNASDKELHLVVMNKSMDSAFDAQFDLSSETTYGFGKVWGFDKTSSQ
IKEAAPITQISGNRFTYTVPPLTAYHIVLTAGKDTSVPPVENPEGFKLKAEAGDGQVHLS
WDASNGVVGYSVQRATDENGPFTTVAASLIETSYTDTNLTNGSSYYYKVTAKTNKGTSES
NILKAVPKVSVNDPVRYEAEDGTLKGTIVESSGTGYSGTGYVTNFHNAGDSLTMTIQAPT
AGLYNLTIGYRSPHDDKRTNFSLNGKAFGELVLGKTADFKETSGGKLLLNAGANTIGFET
GWGWYDIDYVRLEPAADRPPHAVTKTLTNPNATVEAKALMNYLVDQYGKNMLSGQEEMNE
IDWLQANVGKKPAIAALDLIDYSPSRAEHGLSSTETEKAIAWDKQGGIVTFAWHWNAPKG
LIDTQGKEWWRGFYADSTTFDIEYAMSHPESEDYKLLIRDIDVIAGQLKKLQDAKVPVLF
RPLHEAEGKWFWWGAKGPEPVKKLYILMHDRLTNVHKLNNLIWVWNSVAPDWYPGDEYVD
ILSFDSYPQAGDYSPQIAKYEDLVTLGKDKKLVAMSENGPIPDPDLMKAYQAHWSWFATW
YGDFLRDGKQNSLEHLKIVYNHPNVITLDELPTNLKTYGITEQPSVPGSFTLNAAGETAK
VSLSWTASANAKSYEVKRSTAENGAFATVVSDVYGSSYTDTAVTADTTYYYQVVAKNDAG
QTLSNTASAAPKVDTQQPTTGLLLQYRTADTKVNDNHLNPHFQIVNQGTTPVPLNELKIR
YYYTIDGDREQTFNCDYAALSCSKLNGKLVKMEKAATSADYYLEVSFNSDAGVLAPGGST
GEIQTRIHKTDWSNYNESDDYSYKGTQTSYADHMKATLYHNGVLVWGTEPTAN
Download sequence
Identical sequences gi|507717481|ref|YP_008050090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]