SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|507717821|ref|YP_008050430.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717821|ref|YP_008050430.1|
Domain Number 1 Region: 473-615
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000038
Family Histidine kinase 0.013
Further Details:      
 
Domain Number 2 Region: 349-399
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000994
Family HAMP domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507717821|ref|YP_008050430.1|
Sequence length 619
Comment two-component system, sensor histidine kinase YesM [Paenibacillus polymyxa M1]
Sequence
MCTLSKGAVIMMSGRVGTILRSMWKRITQKLVNKLILLFTSVIILVVGSLTIISYQMIEK
ESVNHSIASTTNNLLLVNQNLEDYLEGMQQLALPQLRYNDIMNAIANENRDYAARMVIEN
YLRNMFYSRNDLEAIYLYVADRHQYYVVTRETYNITVRKGINTDLPKLPWYKEAMASTAN
ESFQSFVESRSDMGYVAPQASFMAYHRVLRSIASRHPQAVLSFYYNTSAVDEIMRNIPLG
KGDQLMLISPERVPFYVNSLPLYERMRDSGVLAQIGEGGSGQVTWSDSNSNQEYLVVYDA
GQKDGWQLIKPIPYRQIYEAATTTRNWSYVIGALFLGVSIILVTLTSNAITRPLHKLSTQ
MKRFSTGDFEARAPVKGHDEIAYLSLHFNEMVQRTEELINERYRMKLVEKNAILKALEAE
INPHFLYNALQAISTQALKREMFDMADMVDALAQTLRYSINGKDIVAACEELRHIERYIG
LQKARFGARLRVEVVWEDTLMELPIPRLSVQTLVENSIKHALEKVSSDILIVISAESGAT
DATIAVRDNGPGISEDKLKVVLDSFDEKWEDRESEHIGLKNLNTRLKLLYGDQAGLFILT
DETGTEMRMQIPRGGVSHV
Download sequence
Identical sequences E3E7F5
gi|507717821|ref|YP_008050430.1| gi|310644648|ref|YP_003949407.1| WP_013373699.1.14980 WP_013373699.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]