SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|507717988|ref|YP_008050597.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507717988|ref|YP_008050597.1|
Domain Number 1 Region: 434-601
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.45e-51
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 362-444
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.73e-21
Family Homodimeric domain of signal transducing histidine kinase 0.00089
Further Details:      
 
Domain Number 3 Region: 250-369
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000593
Family Heme-binding PAS domain 0.042
Further Details:      
 
Domain Number 4 Region: 204-253
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000667
Family HAMP domain 0.0043
Further Details:      
 
Domain Number 5 Region: 61-178
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000746
Family Sensory domain of two-component sensor kinase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507717988|ref|YP_008050597.1|
Sequence length 609
Comment two-component system, OmpR family, sensor histidine kinase VicK [Paenibacillus polymyxa M1]
Sequence
MRWLSFFRTIHAKLIIIYVLLILVAMQLIGVYFVSSMKNSLTSNFTQDLQARAEMLSVLA
EQDLSGSDGKMEEDSVESLRARVNNLFDFSGAEIQVLDASGKVLITSQGSHADYVGRKNT
QTVVSRALQGIRDNEEYMVDEDNVRKKVVAKPVISQGKIVGAVYIAASMAELYDTMKRIN
NVFLSGMLIALALTAVLGVVLAHTITHPIKVMTRHATEVAEGKFDQQMPVFGEDEIGRLS
VAFNYMTGRLREALSQNEEEKEKLSSILTNMSDGVVATDDHGRVILVNRRASAMLGVNEN
EMTGRHIAVLLGIDPEETEALYSGSSASTLLQLEPAGQDEPIVIRVTFTPIHRREFGITG
TIAVLQDVTEQEEMETTRREFVANVSHELRTPLTTIRSYAEALDDGAMAEPQLAERFVGV
IRNETERMIRLVTDLLHLSRLDSNEAPLRMQPADVMEMLDEVADRFSFQMKENHIRSGMF
VEQGIGKVVIDRDQIDQVLDNLMSNALKYTPEGGSIRIEARRNNEGMLAISVQDTGIGIP
KKDLDRIFERFYRVDKARSRNMGGTGLGLSIAREIVKAHGGQIFLESEYGQGTCTTFTLP
MSGEGREAQ
Download sequence
Identical sequences E3EC14
gi|507717988|ref|YP_008050597.1| gi|310644836|ref|YP_003949595.1| WP_013373887.1.14980 WP_013373887.1.31500 WP_013373887.1.57060 WP_013373887.1.6267 WP_013373887.1.91857 WP_013373887.1.99789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]