SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039250|ref|YP_005958204.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039250|ref|YP_005958204.1|
Domain Number 1 Region: 31-88,138-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000589
Family SMI1/KNR4-like 0.016
Further Details:      
 
Domain Number 2 Region: 213-393
Classification Level Classification E-value
Superfamily ARM repeat 0.000000181
Family PBS lyase HEAT-like repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039250|ref|YP_005958204.1|
Sequence length 444
Comment hypothetical protein PPM_0560 [Paenibacillus polymyxa M1]
Sequence
MWFGKNETQLDRIKDKLNQAMHKDKDFSVFGASSHQYRVKEKLTAKELADWQAHNQVILP
EPYALFLTNIGNGGAGPYYGIYPIEKATSYTEHQALLAKSVLHLGMAKEEWNHLIEPLTK
DEDIPDEEYDDARNKVLGGMLCIGTQGCEYDMYLVLEGKYRGRIVYTSDFHPDHPFFFVY
EDSFLDWYERWLDEIILDYDIGWFGSRMPGDENALIQMYQSAPNEEIQAKALDGMFKFKE
VAQPTLGFLKNIAEQSPKNRTTAVWLICKTSFDTGRKYLLELLQSDEHRDFLQALTILHA
SSKTANLTEFIPVILQSLDRIHDPETLRYAGYILEDYGEITLRNFAPFLCHADPKMQTTA
IYAARSCENKQGSWQIIEQMLIGSDPQVLKNMILYWGIIPHEKLLPYYKAVWPEYKKNPN
FKEKFIGCLRELHLPDDYFNKDES
Download sequence
Identical sequences E3EF64
gi|386039250|ref|YP_005958204.1| gi|310640067|ref|YP_003944825.1| WP_013369223.1.14980 WP_013369223.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]