SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386039731|ref|YP_005958685.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386039731|ref|YP_005958685.1|
Domain Number 1 Region: 3-315
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6e-101
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000238
Further Details:      
 
Domain Number 2 Region: 318-455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.23e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386039731|ref|YP_005958685.1|
Sequence length 463
Comment beta-fructofuranosidase (levanase/invertase) [Paenibacillus polymyxa M1]
Sequence
MNKSDAYHLKYHIIPPYGLLNDPNGLAFFNQQYHVFYQWNPQGTEHRNKCWGHVVSSDLV
HWQRKGVALEPSEWYDKDGIYSGGAIVHDEKLYLFYTGNVIRNDGVKESYQCAAISEDGE
HFQKMGPLFEHPKGYTRHVRDPKVWRDRNGSWWLILGAQREDLTGETLIYKSADLSDWEY
QGSFLDHDHEFGYMWECPDLLQFAENDIFVFSPQGLPEAGEYYRNPNQSGYIVGKFMDTG
KFSGNLAHFKELDRGFDFYAPQSFKVNDRTIMFGWMSAMNEEAERAVPTIQEGWIHALTL
PREIVLSNGVLYQKPLSELQLLRLDGVHSKENIHKNGVWMLPSLQVECIVHFSKLTENFK
MIVRNAVEIDYDSEENSLTVWRTNWLTNQREYRKATLANQLVDMQIFIESSSLEIFVNEG
EEVFSLRYFLEDTEQRSVMLDAGDNEGEIEIYQLQECGAIINH
Download sequence
Identical sequences E3EFF9
WP_013369755.1.14980 WP_013369755.1.91857 gi|310640605|ref|YP_003945363.1| gi|386039731|ref|YP_005958685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]