SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386041536|ref|YP_005960490.1| from Paenibacillus polymyxa M1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386041536|ref|YP_005960490.1|
Domain Number 1 Region: 75-282
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.4e-31
Family Acetylhydrolase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386041536|ref|YP_005960490.1|
Sequence length 315
Comment uncharacterized protein ypmR [Paenibacillus polymyxa M1]
Sequence
MFISPSYQEGTRVNSSKWIWRSVGSVSIAATLLLLYGFIAAVRSITAPEPLVSTQPVQSG
SSQTQTAPSATAQTEELRVAAIGDSLAKGTGDDSGSGFVRRSVTLLNDQEGHKARLINNL
GINGLTTQGLLTKLDEPGVSYVLKKANVIIVSIGGNDLFQGAQAAQTGKEPPTLSGLRKA
LPDAAKRLQKVLTKVGKINPNAKIVYVGLYNPFSDLREMKIPGNLVVTEWNMAAMAITNQ
NSNMTLVPTFDLFEQNLPVYLSSDHFHPNGQGYQAIAERIAQGFAVTATKGTDHVNPNQQ
STSSQPAEAKKGGNK
Download sequence
Identical sequences E3E7V0
WP_013371583.1.14980 WP_013371583.1.31500 WP_013371583.1.41886 WP_013371583.1.57060 WP_013371583.1.91857 WP_013371583.1.99789 gi|310642466|ref|YP_003947224.1| gi|386041536|ref|YP_005960490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]