SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315444934|ref|YP_004077813.1| from Mycobacterium gilvum Spyr1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315444934|ref|YP_004077813.1|
Domain Number 1 Region: 13-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-46
Family Ribonuclease PH domain 1-like 0.000000404
Further Details:      
 
Domain Number 2 Region: 329-500
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-44
Family Ribonuclease PH domain 1-like 0.00000166
Further Details:      
 
Domain Number 3 Region: 157-268
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.78e-27
Family Ribonuclease PH domain 2-like 0.00000971
Further Details:      
 
Domain Number 4 Region: 482-586
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.42e-22
Family Ribonuclease PH domain 2-like 0.000021
Further Details:      
 
Domain Number 5 Region: 594-681
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.23e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 273-352
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.62e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00022
Further Details:      
 
Domain Number 7 Region: 662-730
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000307
Family Cold shock DNA-binding domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315444934|ref|YP_004077813.1|
Sequence length 756
Comment guanosine pentaphosphate synthetase I/polynucleotide phosphorylase [Mycobacterium gilvum Spyr1]
Sequence
MSVVEIEEGVFESTATIDNGSFGTRTIRFETGRLARQAAGAVVAYLDDETMLLSATTASK
QPKEHFDFFPLTIDVEERMYAAGRIPGSFFRREGRPSTDAILTCRLIDRPLRPTFISGLR
NEIQVVVTVLSLDPKDLYDVLAINAASASTQISGIPFNGPVGGVRVALIDGQWVAFPTVE
QLEKAVFDMVVAGRKVGDAGNEDVAIMMVEAEATDKVIELVAGGAGAPTEAVVAEGLEAA
KPFIAALCDAQAALAGAAGKETAEYPVFPDYAEDVYYSVASVATDALSEALTIAGKEARD
DRTNEIKAEVVERLAEQYAGREKEIGAAYRSLTKKLVRQRILTDHFRIDGRGVTDIRALS
AEVAVIPRAHGSALFERGETQIMGVTTLDMVKMAQQIDSLGPETSKRYMHHYNFPPYSTG
ETGRVGSPKRREIGHGALAERALMPVLPSVEEFPYAIRQVSEALSSNGSTSMGSVCASTL
SLLNAGVPLKAPVAGIAMGLVSDDVEVEGGGVERRFVTLTDILGAEDAFGDMDFKCAGTK
DFVTALQLDTKLDGIPSQVLAGALAQAKDARITILEVMAEAIDEPDEMSPYAPRITTIKV
PVDKIGEVIGPKGKMINSITEETGASISIEDDGTVFVGASNGEAAQAAIDKINAIANPQL
PKVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGRGKRINKVEDVAKVGDKLRVEIA
DIDNRGKISLVLVAEEEAGAATPEAPAPADAATSSS
Download sequence
Identical sequences A4TCH6 E6TFK2
gi|315444934|ref|YP_004077813.1| WP_011894873.1.11461 WP_011894873.1.22401 350054.Mflv_4023 gi|145224603|ref|YP_001135281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]