SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332664269|ref|YP_004447057.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332664269|ref|YP_004447057.1|
Domain Number 1 Region: 114-174
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0000000451
Family TonB 0.036
Further Details:      
 
Weak hits

Sequence:  gi|332664269|ref|YP_004447057.1|
Domain Number - Region: 44-98
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000222
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332664269|ref|YP_004447057.1|
Sequence length 199
Comment TonB family protein [Haliscomenobacter hydrossis DSM 1100]
Sequence
MIQCFPRSKQVAERYSVLKSDRTVKHGSYVAFFKMSEKDYERFQMGVLKLEDFVKIKGNY
QLGKKGGEWEEYIQPQVLKTKGNYLGDKKIGVWFTAREEAQVIERYDFDLQKKLRPIFQI
KVVYPENARKAGHMGTISLSFQTSSDCTVSNITLLQSASPALDNAAMIWMKKYAVYLKNY
GVECTEKIDTQIVVFNLEE
Download sequence
Identical sequences F4KU87
gi|332664269|ref|YP_004447057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]