SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332665947|ref|YP_004448735.1| from Haliscomenobacter hydrossis DSM 1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332665947|ref|YP_004448735.1|
Domain Number 1 Region: 368-648
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3e-66
Family RecA protein-like (ATPase-domain) 0.0000000695
Further Details:      
 
Domain Number 2 Region: 328-402
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-27
Family Cold shock DNA-binding domain-like 0.0000816
Further Details:      
 
Domain Number 3 Region: 3-45
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000126
Family Rho termination factor, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332665947|ref|YP_004448735.1|
Sequence length 695
Comment transcription termination factor Rho [Haliscomenobacter hydrossis DSM 1100]
Sequence
MFDILQLNDMLVPELRELAERLGIQGYRKLNKKELVYKILDYQALAEGSERPAFEPGEDL
DIPASITSREQFQNELYRPDDDEPSVSKSTTPEEPSSTDPADGSEEDDAADRNKRTRRRV
TREELEQQQALTRRDRNMPKLERTRDRNERTEKPERDPERDERGGRVEPQRPTREERPSR
DERPIRDERPSSRDERPSREERPSRDERPTRDDRPSRDERPTRDDRPSRDERPERNERTP
RFEREQRPERNDRDRDRYDRDRDRDRDSRDRDGDRDRDRDRDREPEREREGARFEDAPER
RQPAAEEFDDYSREEEERFDIELDGIIEGEGILEMMPDGYGFLRSADYNYLTSPDDIYVS
PSQIKLFGLRTGDTVCGAIRPPKEGEKYFALLRVSKINGRDPAEIRDRVPFDYLTPLFPT
EKLRLVGAPGSRNIGNRMIDLFTPIGKGQRGLIVAQPKTGKTFLLKDLANAIAKNHPECY
IIVLLVDERPEEVTDFKRSVHAEVVASTFDEPAENHVRVAGIVLEKAKRLVECGHDVVIM
LDSITRLARAYNTVAPASGKVLSGGVEANALHKPKKFFGAARNIEGGGSLTILATALIDT
GSKMDGVIFEEFKGTGNMELQLDRGLSNKRLFPAIDLTKSSTRRDDLLLDKDTLQRMFIL
RNHLSDMKPEEAMEFLRKHMNMSNSNDEFLLSMNG
Download sequence
Identical sequences F4L5M7
WP_013766400.1.50710 gi|332665947|ref|YP_004448735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]