SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336065794|ref|YP_004560652.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336065794|ref|YP_004560652.1|
Domain Number 1 Region: 7-83,175-344
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.66e-60
Family Bacterial dinuclear zinc exopeptidases 0.0000509
Further Details:      
 
Domain Number 2 Region: 73-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.82e-28
Family Aminopeptidase/glucanase lid domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336065794|ref|YP_004560652.1|
Sequence length 354
Comment glutamyl aminopeptidase [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MLNEKQLNWFETLTQLDGVSGHEHQVAQYLFNEYSNYTDEILRDNLGSILAVRRSNKKNA
PKVLVLGHMDEVGFLVREVTETGVLKIHPVGGWFSQVLLGHRVRVTTRHGEVYDGAIGAT
PPHMLSAEERLKPIQIPQMTVDVGATTPEEVHAMGIQIGDMVVVDGEFNVLNKGKRLLAK
AFDNRYGCVMGLDLLEALKDQELDYDLYVGCSVQEEVGLRGAQTVANLVKPDLAIILDCS
PANDALDSKAIGKLGGGVLVRVMDGNMIATKDLIYKFVDICNEHDIKHQYYFSPGGTDAG
AVHKSNSGVKTLTCCLCARNIHTSSSILDTDDYLAAREALLHFIDKKTWGDVIA
Download sequence
Identical sequences F5WS79
gi|336065794|ref|YP_004560652.1| WP_013852747.1.1456 WP_013852747.1.27465 WP_013852747.1.5295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]