SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336065890|ref|YP_004560748.1| from Erysipelothrix rhusiopathiae str. Fujisawa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336065890|ref|YP_004560748.1|
Domain Number 1 Region: 533-594
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000114
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336065890|ref|YP_004560748.1|
Sequence length 598
Comment putative endo-beta-N-acetylglucosaminidase [Erysipelothrix rhusiopathiae str. Fujisawa]
Sequence
MKLSQLKKRLLKLIICAVILGIVVVNSNASIHADQKGLEGFTQVLDPEIEQLRDEEDLGE
LDLNENPEVPSLGGEDNETVTVLNQMRSFSAGARAQRTEGIIEPNGSGKSTILLYNKSTG
EAARTYISDGVLYSGVFPFYKKENNRYQIQIAGAVGWVNASNFREYSFAEAKSMNMYKVN
SDNELVHYISRGANQTKAATILLGPAPSYLRQGVNYYSADGHYFYTNLKTMVADLKLNKN
AGALNSTNPWYNYYQFLSNRAKSAVTAQDINKYLARKGYTAAPSPKVTEVENLKPNESLL
VGSESHFINEGKKYGINPLITFGTAVNESGWGRSNIALKDKNIFGHEAYDSSPESATVYE
SVGMSISNHMTHFLNWHYMDVTEANYFGGYLGDKQSGINVKYSSDPFWGEKAAEYFYIMD
WYMGMKDYKQYTIGLVTSSGSPSVYKEANGSSASIYKLNVTGQHVLILDEIKKGSEVWYK
IAADPLLTSNRDLMPWDTTTRPFKTPYNENHNYGYVKGSEVKTVAGKLHKETNMKRGDVN
GDGKISLIDLAMVKSHLLGNSKLSGDSFARADVNGDGKLSLLDLAMIKSHLLGNSNLN
Download sequence
Identical sequences F5WSH5
gi|336065890|ref|YP_004560748.1| WP_013852826.1.1456 WP_013852826.1.27465 WP_013852826.1.4665 WP_013852826.1.5295 gi|509152546|ref|YP_008072787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]