SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315230756|ref|YP_004071192.1| from Thermococcus barophilus MP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315230756|ref|YP_004071192.1|
Domain Number 1 Region: 4-148
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.28e-38
Family AlaX-like 0.00000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315230756|ref|YP_004071192.1|
Sequence length 151
Comment alanyl-tRNA synthetase domain-containing protein [Thermococcus barophilus MP]
Sequence
MNELEVRTHTALHVVKGAVVKVLGEKAKWTASVYVNGNHGRLTVKFDRKPTQEEIAKIER
MANEKVKENVPIHVYELPREEAEKRFGEDMYDLFPIPPEIKTLKVVVIENWNVNACNKQH
TKTTREVGKIKIKKVRFRKSKELLEISFDVL
Download sequence
Identical sequences F0LMJ0
gi|315230756|ref|YP_004071192.1| WP_013467267.1.91259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]