SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315231455|ref|YP_004071891.1| from Thermococcus barophilus MP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315231455|ref|YP_004071891.1|
Domain Number 1 Region: 92-238
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.01e-35
Family AlaX-like 0.0057
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000706
Family AlaX-M N-terminal domain-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315231455|ref|YP_004071891.1|
Sequence length 408
Comment alanyl-tRNA synthetase [Thermococcus barophilus MP]
Sequence
MTAKLFYEDAYLNEAKAKIESLEIRGNKVRLNLDRTIFYPEGGGQPSDKGIIRGDGFEIR
VEKVYGKDEIWHEGTLKGREPKPGEEVELELDWEWRYENMKQHTGQHILSAVLKDLYDSN
TTGFQIFENYNKIEINFNGKLTWEHILNAEIRANEIVSKDLPVEIEFYNELPEDLRNQLR
KDLSDKIKPPIRIVSIPGVDVIPCGGTHVKSTREVGFIKVVNFYKKSKNIWRIEFVCGNR
ALRYLDELLEDYWESLDEMPNKNRPLIKRVRELKNEIVKLEEEKKALRLELWEWKAKALL
RGSEEVKGIKIVSTVEELDMKDAQAFVVYLVDKNPNTIALFVGRNYVIFAKNRGVEGVSM
KELLREVIKETGGGGGGSEVLAKGGGFKVEPEKVLEIAKEKLKQLLQV
Download sequence
Identical sequences F0LJM6
WP_013467966.1.91259 gi|315231455|ref|YP_004071891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]