SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|315231477|ref|YP_004071913.1| from Thermococcus barophilus MP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315231477|ref|YP_004071913.1|
Domain Number 1 Region: 57-264
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.34e-58
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 311-502
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 4.32e-49
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0001
Further Details:      
 
Domain Number 3 Region: 599-748
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-48
Family AlaX-like 0.00095
Further Details:      
 
Domain Number 4 Region: 512-595
Classification Level Classification E-value
Superfamily Translation proteins 3.43e-20
Family AlaX-M N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315231477|ref|YP_004071913.1|
Sequence length 911
Comment alanyl-tRNA synthetase [Thermococcus barophilus MP]
Sequence
MSMDMTTKMFKEEGWIRKTCKVCGKPFWTLDPDRETCGDPPCDEYQFIGKPGIPKKYTLE
EMREAFLSFFERHGHGRVKRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLTIS
QPSIRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKPIYWMDETVELAFEFFTKDLKMKPE
DITFKENPWAGGGNAGPAFEVLYRGLEVATLVFMQYKLAPPGTPDDQVVIIKGDRYVPMD
TKVVDTGYGLERLVWMSQGTPTAYDAVLGYVVEPLKRMAGIEKIDDRILMENSRLAGMFD
IEDMGDLKVLRREVAGRVGISVEELERLIRPYELIYAIADHTKALTFMLADGVVPSNVKA
GYLARLLIRKSIRHLRELGLQIPLSEIVAMHIKALHKTFPEFKEMEDVILDIVNVEEKRY
QETLKRGSDLVRREIKKLRKEGKDEIPLEKLILFYESHGLTPEIVKEIAEKEGIKVHIPD
NFYSLVAKEAEKMAKEEKEEKIVDFELVRDLPDTRTLYYEDPFMKEFDAKVLKVIDDWVV
LDKTAFYPEGGGQPYDTGELNGVEVLEVQKVGKVILHRVKDPGKFKEGMTVHGKIDWERR
IQHMRHHTGTHVLMGALVRVLGKHVWQAGSQLSTEWARLDISHYKRISEEELKEIERLAN
RIVMEDRKVAWEWLPRTEAEQKYGFRLYQGGVVPGRIIRILNIEDWDVQACGGTHLPSTG
LIGPIKILRTERIQDGVERIIFACGEAAIKEWQRERDIIKKTSEVFRVPPEKLPETAEKF
FEEWKQARKEVEKLKKELAKLLVYELENKVEKIGEIEFIGEVVEGDLDHLREAALKLKKP
KRVTALISEDTNAVVVAVGDEVPFKAGELIRIITSIAGGGGGGKKDLAQGKIKDVRKARE
ALEELRKRLSS
Download sequence
Identical sequences F0LJP8
WP_013467988.1.91259 gi|315231477|ref|YP_004071913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]