SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|31307|e_gw1.9.34.1 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Naegr1|31307|e_gw1.9.34.1
Domain Number 1 Region: 8-163,211-247
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.54e-33
Family Phospholipase D 0.033
Further Details:      
 
Domain Number 2 Region: 257-377,410-461
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.71e-29
Family Nuclease 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|31307|e_gw1.9.34.1
Sequence length 530
Sequence
MQITQATELNNRFHSFAPERDNVKIKWYVDGKDAFRDIAIAMDRAKEEIFISDWLLSPLM
YLIRGDAPRVAESRLDILIKNKAAQGVKIYIILWKETSVAGLNLDTRQTKKYLRSLFPRN
IYVCSHPKRYPINFTHHQKIVVVDQSVAFIGGLDLAYGRWDDHHHSLTDDNHTALKFPGG
DYMNPNLVPSTRFEDKLAHFKDTFDREFIPREPWHDVHSMVSGLLARDVALNFIERWNQH
TKATPSTALQLKTEISCPDDEGFVCNAQVVRSISRWSGGNDTEQSIYLSYLHLIEEAQHY
IYIENQFFIGGTAGSPVKNAIPLFIGRKVVEKMRRGEVFRVYIVVPSHPEGDVAIASVQQ
LMKFQYKTINRSSTSLFNYIKQEYPQATEELIEQYITESSFVDKIPTGKRAVTEHVYVHS
KVMIVDDRHTIIGSANINDRSMLGNRDSEIAVVISDKSFTTSKMNGRPYRAGKFAHSLRL
RLWKEHLGLKRSQIEDPIHNETHNILMTLAKKNTEIYDTVFTDIITDRYK
Download sequence
Identical sequences jgi|Naegr1|31307|e_gw1.9.34.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]