SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|59623|estExt_fgeneshHS_pg.C_680038 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Naegr1|59623|estExt_fgeneshHS_pg.C_680038
Domain Number 1 Region: 407-452
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000208
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Domain Number 2 Region: 358-397
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000638
Family Ovomucoid domain III-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|59623|estExt_fgeneshHS_pg.C_680038
Sequence length 491
Sequence
MKSLLVLLMLLGVATLLMMITPASLQKELPITIQSSTKDKVMDEYLKQITVETIDSNDDS
GNKTVNCCNVCPVPKIIIIPKYTTIKVPINIPYPVLKPIPPHHDDDVVDKCPSDYQFVPP
NKCSKTIIIEKKKNCPIGFIRIGETECLRLVIIHNNIPPMKVVCPPGYIPFVISKNSEEY
LKLKDLPKDLPSNDFFFKNDTKNTVLGCKKSKKIHIDEEIPHWTCPKGYYYHSPFHCVKS
VECPKKGGWIKLTDGRCIRTLFKCPRGYKKVGRHGLTCIKINMKCPKGYRQSKKNPRLCL
KTKIIVKIKCPKKSIYSEEKKTCIWKKCATVRCNGALKCPKGQILALKSKKDCCPSCVPC
ACSAEYHPVCTKDGVTVFNLCSAKCLGLEVKHEGECKITEIIKITKTCPPCDQCKNVPKK
PVCGVDGVTYPNTCVAKCVTSGKFEMKRKGKCSPADCDEAESNKTVSEFLPFFERVLKSE
LINAKQRKQKK
Download sequence
Identical sequences D2VYV4
XP_002670719.1.8020 jgi|Naegr1|59623|estExt_fgeneshHS_pg.C_680038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]