SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|79550|estExt_fgeneshNG_pg.C_210035 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Naegr1|79550|estExt_fgeneshNG_pg.C_210035
Domain Number 1 Region: 120-374
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-49
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 
Domain Number 2 Region: 466-659
Classification Level Classification E-value
Superfamily TPR-like 2.28e-16
Family Tetratricopeptide repeat (TPR) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|79550|estExt_fgeneshNG_pg.C_210035
Sequence length 670
Sequence
MFNLFNKNVQVIIVEENTVERLLVVEISTNTRTIKELKKIVSKTISLENRSLKYKFDSEE
FCLSKDIDVETMITKFRGSAKIEHKLICYKSFRPSISSKEKAEKLKKKLAEKYNVDQNSI
SLLGKGGFGFVFGLPPIENSIPIAVKVLIDDNGNDLLNEVKTTLSMNHPHIVEAGNFFTL
NNVSYFKSVVCYEMERMLGTLKNFFLDDDGKKKLRNITEHIAVMIINQVSQAFQACVDRK
VCHRDVKPDNILVKSISDDSIHVVLSDFGSAFTSSKFNRQVNIEMEGTVRYLAPEVVEDC
KNFSIQSDIFSLGITLYYLMIGRFGATGEILCEKPEQVERHLVELSISPFVSQLILGMIK
KDPAQRMSLNVLLQLTNDYLNTKKQLFTLQADGEAYRIELPFYPKYDELVKLIEKKLGHN
DFNLTHNQEIVTNDSECYQMITSLLSKDPKQRVITLKLSPINEVLQNASKNYENGNYEIA
LKFCDQYLKRSSASLTILTKAANCCFYLKNYEKAIEYFSKAYSVKEWKSRLDVKFYERFA
YCYFNIRKYENAYSLYEKALSKENYKTFYLAGLCALKTNLFERSVALLSKSYSLKRNIEA
IDAIVQVLQQLSSPLNIYSWTDEGIALFAHGIYMKKLNELDESRKLLERALDKLPNDDEF
IVEALRSIQP
Download sequence
Identical sequences D2VDN5
jgi|Naegr1|79550|estExt_fgeneshNG_pg.C_210035 XP_002677776.1.8020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]