SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338174107|ref|YP_004650917.1| from Parachlamydia acanthamoebae UV-7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|338174107|ref|YP_004650917.1|
Domain Number - Region: 200-318
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000608
Family BCR-homology GTPase activation domain (BH-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338174107|ref|YP_004650917.1|
Sequence length 396
Comment hypothetical protein PUV_01130 [Parachlamydia acanthamoebae UV-7]
Sequence
MSSPVNSPRSSGEYKVEAANLGEIASANKTVQTNEIDASVEQAADKVLNKSASERKSIPT
RPLSDNADSVKERNQNKATQSNLSKFLQFFTHIGKRSKKQKTEQDSFETEMTEMKWQTNA
AFHDENKVSSEAIKKMATPEAQETKKKSSGIKSFIQGIIKFVKSHNPLARITRTKKAVVE
ETKEVEKSLPSNIEPYHNLVKQMINRLEQGEKKGSIPLGLFRVSGSKTTVEKAVTDFKET
EGHQDLPSDWHDATSMIKNTVMSQKAPPMQKIKDLNIPAVHAEAVDQKKSEEEIIQNIQG
AIFKLDSEERNFLKDYLKMIDLTYQKSWPKEQAPGDKDPFTAYLQGTPSLTNVFSHESLA
DALFASMGTQKTVNLGYVEFLVNNREKIFQTEKTEI
Download sequence
Identical sequences F8KUZ7
gi|338174107|ref|YP_004650917.1| WP_013924142.1.46663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]