SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338174948|ref|YP_004651758.1| from Parachlamydia acanthamoebae UV-7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|338174948|ref|YP_004651758.1|
Domain Number - Region: 88-120
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0524
Family HNH-motif 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338174948|ref|YP_004651758.1|
Sequence length 338
Comment hypothetical protein PUV_09540 [Parachlamydia acanthamoebae UV-7]
Sequence
MALKPLYNVMVEKVLSSKNIFIDETPVKLWEIEKCKQAYMWVVVGGNESNPAYRIYDFRQ
DRCHEHVLDILKNYCGGLHSDKYAAYQRLAERKIITWFPCWSHIRRKFFEAEAGDPAFRK
WILRKIRYLFMLERVAWARLPEERLRIRQEKEVPIIDDLIEKIKSKLTDGKILPKSKLKE
AMGYFCGLIPYLKNYTKDAFARLDNNAAERAVRPLAIGRKNWLFFGSPDGGEAGAILLSL
VQTCRGLGINPREYLEDVMRRIMGHNSQKIYELLPDEWLKNRNQKAVTQSVFYYRVHLAK
QKRLLVDYEPSFPVVSIVASDSLLYSPYAKRGHDQNFP
Download sequence
Identical sequences F8KW88
gi|338174948|ref|YP_004651758.1| WP_013924676.1.86004 WP_013924676.1.96470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]