SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|194333235|ref|YP_002015095.1| from Prosthecochloris aestuarii DSM 271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194333235|ref|YP_002015095.1|
Domain Number 1 Region: 104-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-69
Family RecA protein-like (ATPase-domain) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 64-139
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8e-28
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 3 Region: 11-55
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000432
Family Rho termination factor, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194333235|ref|YP_002015095.1|
Sequence length 429
Comment transcription termination factor Rho [Prosthecochloris aestuarii DSM 271]
Sequence
MSNNSVTKGLDINMLQKKKVHELNALAKEIGVSSAGLRKEELIYKIIEAQSQKGGSAENG
QVMVNTGVLQVIPEGYGFLRSANYNYLSSPDDIYVSPSQIKRFNMRTGDTVSGQVRAPKE
GERFFALLKIDTIDGKDPEITRIRPFFDNLTPLFPTERLMLETKQNEHCGRIMDIYTPIG
KGQRGLIVAQPKTGKTMLLQTVANAIIKNHPEVYLIVLLIDERPEEVTDMQRSVPAEVVS
STFDEDPERHVQVADMVLEKAKRLVEVGHDVVILLDSITRLARAHNTIIPHSGKILSGGI
DANALTKPKRFFGAARNIEEGGSLTIIATALVDTGSRMDDVIFEEFKGTGNMELVLDRRL
SERRIFPAIDILRSGTRKEELLFTQQELSRTWLLRKYLADKNPIECMEFMREKMSDTKDN
KEFFKYMNG
Download sequence
Identical sequences B4S4V0
WP_012504985.1.66998 gi|194333235|ref|YP_002015095.1| 290512.Paes_0391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]