SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000001516 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000001516
Domain Number 1 Region: 198-239
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000068
Family HLH, helix-loop-helix DNA-binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000001516   Gene: ENSETEG00000001866   Transcript: ENSETET00000001867
Sequence length 284
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_1155:20157:30579:-1 gene:ENSETEG00000001866 transcript:ENSETET00000001867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTLIRHPSELMNVPLHQQQNKCTTLVKNKTAAATTALQFTYPLFTTNACSAANANLSQT
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEALC
KQAIKGIRSRTRELDTNVEPRTPGEIQNVGKGAAGTRGAWRSAEPSXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRRIRICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGD
SLKKEFESVFCGKTGRRLKLSRPDPLLACPAQEGLQSSPAMEVK
Download sequence
Identical sequences ENSETEP00000001516 ENSETEP00000001516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]