SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000000053 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000000053
Domain Number 1 Region: 782-981
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-51
Family DBL homology domain (DH-domain) 0.00000000558
Further Details:      
 
Domain Number 2 Region: 985-1116
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-41
Family Pleckstrin-homology domain (PH domain) 0.000000418
Further Details:      
 
Domain Number 3 Region: 43-122
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000168
Family PDZ domain 0.023
Further Details:      
 
Domain Number 4 Region: 350-427
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00001
Family Regulator of G-protein signaling, RGS 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000000053
Domain Number - Region: 149-159
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0243
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000000053   Gene: ENSETEG00000000064   Transcript: ENSETET00000000065
Sequence length 1555
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_8428:173019:331544:-1 gene:ENSETEG00000000064 transcript:ENSETET00000000065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLTSLSSLGDSALERKSPSHHRQHSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPXXXXXXXXXXXXXXXXXVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGVSGLQQDPAPAGAPRVTAVIPPPPPPPPLPPPQRITGPKPLQXXXXXXXXXX
XXXXXXXXXEKELQRICEVYSRNPDSLLEEQIEGTRRRVAQLQLKIQQETGGLVXXXXXX
XXXXXXXXXXRLSLDSQEGDSGLDSGTDRFSSLSESLMNRNSVLSDPGLDSPRTSPVTMA
RMTPHHKRQGLEVPVPLTSEQGVDQSSKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLRVKIP
EMLQAEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPMDFALNTYMSHAGIRLREARPSNPAEKAQ
AAPDKDKWLPFFPKTKKSSNSKKDKDALEDKKRNPILKYIGKPKNSSQSTFHIPLSPVEV
KPGNVRNIIQHFENSQQYDVPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREE
MKRSRKGENVPRSRSDVDMDAAAEAARLHQSASSSASSLSTRSLENPTPPFTPKLGRXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLFVTEASHLRTLRVLDLIFYQRMKKESLMPREELARLFPNLPELIEIHNSWCEAMKKLR
EEGPVITEISDFMLARFDGPAREELQQVAAEFCSNQSIALELIKTKQRKEGRFQLFMQEA
ESHPQCRRLQLRDLIISEMQRLTKYPLLLENIIRHTEGGTSEHEKLCRARDQCREILKHV
NEAVKQTENRHRLEGYQKRLDATSLERASNPLAVEFKSLDLTTRKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAADSKQTFSPVLKLNALLVRSVATDKRAF
FIICTSELGPPQIYELVAVTSSDKNTWMELLDEAVRNATRHPGAAPVPIQPPPAAHPRRV
PGRVGLDESEVFHRRSSEPEPEELPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENLRRLILCSLQPSPTTGPP
ASAEPEDDLTPTPSVISITSHPWDPGSPGQAPSVGEGGTPQYPGLEGDQPEPEDMVPCSL
EDLPPRTRNSGIWESPELDEDPAEEASHAEAAGGYKVVRKAEVAGSKVGPALPESGQSEP
EPPDVEGGAKAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMELAHRELLKSLGGESSGGTTPVG
SFHAEAVRWTDSSLSPSAKEPLVSDSRDSHELRLCPEDGANSPLEDRATATAPGL
Download sequence
Identical sequences ENSETEP00000000053 ENSETEP00000000053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]