SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000002344 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000002344
Domain Number 1 Region: 437-667
Classification Level Classification E-value
Superfamily vWA-like 2.59e-67
Family Trunk domain of Sec23/24 0.00011
Further Details:      
 
Domain Number 2 Region: 182-454
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.67e-36
Family beta-sandwich domain of Sec23/24 0.0042
Further Details:      
 
Domain Number 3 Region: 690-747
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000000000000157
Family beta-sandwich domain of Sec23/24 0.0064
Further Details:      
 
Domain Number 4 Region: 830-886
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.00000000000392
Family Helical domain of Sec23/24 0.016
Further Details:      
 
Domain Number 5 Region: 985-1028
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 0.00000248
Family C-terminal, gelsolin-like domain of Sec23/24 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000002344   Gene: ENSETEG00000002864   Transcript: ENSETET00000002865
Sequence length 1030
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_5026:8686:134884:-1 gene:ENSETEG00000002864 transcript:ENSETET00000002865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPPYSQAQPGIGLSPPHYGHYGDPSHTASPPNMMKPSGPLGTATPGGMLPPG
PPPPGTHQFGQNGAHASGHPPQRFPGPPPLNNAAPSYPPYSASTPSAYPSPGCTSSVTQL
GNQLSAMQMNNYGSSMGAPNQGPPGPPAAALPGPSRPPPPSILQPGSQVLPPPPTALNGP
GPSPMSPPTHRPDGLPGPAPPNAHYQPPPLPGQTLGTGYPPQQAANYGAQMAGPQLGYPG
GFPGGPAQMAGLPQPQKKLDPDAIPSPIQVIENDIASRGGQVYATNTRGQVPPLVTTDSV
IQDQGNASPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPFATIPSNETPLYLVNHGETGP
VRCNRCKAYMCPFMQFIEGGRRYQCAFCSCVNDVPPFYFQHLDHMGRRLDHYEKPELSLG
SYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTVLENLPKEEQEEA
SAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYQESQSVIHNLL
DQIPEMFAESNENETVFAPVIQAGMEALKAADCPGKLFIFHSSLPTAEAPGKLKNRDDKK
LVNTDKEKVLFQPQSGVYEALAKDCVAHGCSVTLFLFPSQYVDVASMGLVPQLTGGTLYK
YNNFQXXXXXXXXXXXXXXXXXXXXXXXXIMRVRTSTGLRATDFFGGIFMNNTTDVEMAA
IDCDKAVTVEFKHDDKLGEDSGALIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLILPDSMK
VLPVYMNCLLKSCVLLSRPKISTDERTFQRQLVMTMDVADSQLFFYPKLLPIXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLTVVKQREQPEMGFRQFLVEDKGLYGGASYVDFL
CCVHKEICQL
Download sequence
Identical sequences ENSETEP00000002344 ENSETEP00000002344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]