SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000002364 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000002364
Domain Number 1 Region: 644-827
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-37
Family SPRY domain 0.00018
Further Details:      
 
Domain Number 2 Region: 27-112
Classification Level Classification E-value
Superfamily RING/U-box 4.01e-27
Family RING finger domain, C3HC4 0.0094
Further Details:      
 
Domain Number 3 Region: 114-177
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000443
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 362-431
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000179
Family RING finger domain, C3HC4 0.0097
Further Details:      
 
Domain Number 5 Region: 439-500
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000717
Family B-box zinc-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000002364   Gene: ENSETEG00000002889   Transcript: ENSETET00000002890
Sequence length 829
Comment pep:novel genescaffold:TENREC:GeneScaffold_2870:3608:28184:1 gene:ENSETEG00000002889 transcript:ENSETET00000002890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFGGILYAGITFEVRAQVRGARGTAMASTVLVDIRDEVTCPICLELLTEPMSLDCGHSF
CQVCIEGNSKPSEVIPDEGNNCPVCRASYHPPNLRPNRHLANIVERLREAASCPEAQPRA
SLCASHGERLQLFCKEDGKIICWLCEHSVEHRGHHTFLVEEVAQEYKELFQEHLKKLTKE
QQEAAKLTAVTKEKKTRWKASGALAESQMETEIHRVQRQFKQLRSILDKEEKREQKLGDE
RRGLRLIEETEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEFWTLRKPKV
LPTKLRSTFRAPDLKKMLRTFRDLTGVQNFWXXXXXXXXXXXXXXXXXXXXSQGSSAMAT
LNVEEEVTCPICQELLTDPLSLFCQACIVANKEAVIGLESESSCPVCGSRYSLRKLRSNW
HLSKKGERLRKGKWSPQKEQAGELCVHHGEKLLFFCKEDRKVICWLSERSQEHCGHHTFL
MEDVVKECKEKLRATVERLRNEQQEAEKLKTAISEERATRKARETPKGRLRIQVEFKRIR
LILENEELRELQKLEDEEKKVMNKLAEAEDELVQQSQVGKELISDLECRGQWSTMELLQD
MSGIMKWSEIWTLKKPKTLPKKLKHVFRAPDLRGMLRVFTELADVQRHWVDIVLNPVNLN
LNLVLSEDQRQVMSVPIWPVKCDNYGILGSQSFSAGKHYWEVDMSKKTAWILGAYCRFSH
NKMSRVRQAEKYKSVYSRYSPGLQQQLKYVAWEDAFSAHPQIWTLFLAVLPCRVGIFLDF
EACTVSFFNAADHGSLVYRFVKCCFSQNTFPYFNPWNCPGPLTLCPPSS
Download sequence
Identical sequences ENSETEP00000002364 ENSETEP00000002364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]