SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000002943 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000002943
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 1.14e-21
Family Pyrin domain, PYD 0.004
Further Details:      
 
Domain Number 2 Region: 305-360
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000458
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 647-706
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000514
Family SPRY domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000002943   Gene: ENSETEG00000003582   Transcript: ENSETET00000003584
Sequence length 717
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_1592:923:11003:-1 gene:ENSETEG00000003582 transcript:ENSETET00000003584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTLSDHLLNSLEQLLLYDFEKFKFMLQNTNLEKEYSLIPRGVLQMAGPVKLATLMVNY
YGEEDAIRLTLQVLRAINQRFLAEKLQKTTGQDYLTQESGPDSSSGESKPKGLKIPEGLE
GDGPQRSGDGGASLHTVQAEAGKGPQKKSQDRCLDKQGKPGARSMTPPSRRGGPCLAEGL
HPQPQLRRNANSTSRLQEKKRPKSLEFAIPSGERGPVNPETLRSLTNIRIVTPGIVAVLG
AEEAPGGQRKGSRGLEDKPQEGDPVGGSCVHGSSSCSGEHGASGNHSLSCPRGQGSPNSS
SLRSVSSEPPPQCERHKQQPCLLFCEEHSQPVCLICNLSQEHRGHQVRPIEEAALEYQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKTAT
VPEPWATPSEVKEKLHLFYHKSEFVEKSMKRFSENLRSEMETFLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHRWMMEPSQCVRIS
LDYEAGDISFHNVTAKSHLYTFCSPSAPLQPAFSPGSNDGKNMEPTTCPVCVQGQNE
Download sequence
Identical sequences ENSETEP00000002943 ENSETEP00000002943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]