SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000003843 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000003843
Domain Number 1 Region: 495-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000356
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 532-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000148
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 18-48
Classification Level Classification E-value
Superfamily SET domain 0.00000824
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 60-88
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000717
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000003843   Gene: ENSETEG00000004709   Transcript: ENSETET00000004709
Sequence length 632
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_2258:3:8056:1 gene:ENSETEG00000004709 transcript:ENSETET00000004709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARNPQEQTLEAIADIPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEK
GEERYICWYCWRTFRYPNSLKAHLRFHCVLGGGGRAFLHHEHAARQGAAPDGLRLSPKPL
APDFAGTVPTDSLRAHSLVPPPPQACGPREGIKREASAAPSATSPPPGKWGPPRRGKEQA
ERALDMSGAARGHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAPPAAALPGARYAPLPPAAGLPLERCAR
PPLDAGALQAYAGGECGHLPAVLPAFTVYNGELLYGSPAAAAAAYYPLKLHFGGLLKYPE
SLSYFGGAAAAALSPAELGSLAGLDRELAMHTQQLSELAVAKGRLDAGALPQAVGAGSAG
GVGGGGGAGKAKSGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNK
HIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLLLKEGDGXXXXXXXXXXPRQ
PKSDDDDDSDVDVCFTDDQSDPEAGGGGERDR
Download sequence
Identical sequences ENSETEP00000003843 ENSETEP00000003843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]