SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000004441 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000004441
Domain Number 1 Region: 49-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000209
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000004441   Gene: ENSETEG00000005461   Transcript: ENSETET00000005462
Sequence length 412
Comment pep:known_by_projection scaffold:TENREC:scaffold_295677:49833:53704:-1 gene:ENSETEG00000005461 transcript:ENSETET00000005462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPSAQPPPACLPAAPALEPGDLPGMDFAHMYQVYKSRRGMKRSDDSKETYKLSHRLI
EKKRRDRINECIAQLKDLLPEXXXXXTLGHLEKAVVLELTLKHVKALTNLIDQQQQKILA
LQSGLQAGELSGRSIDAGQEMFCSGFQTCAREVLQYLAKHESTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPPDLAPQTTDFKEKPSSLAKGSEGPGKNCVPVIRRTFPHSSGEQSGSDTD
TDSGYGGESEKGDLRGEQPYFKSDAGCRFAMGERISTIKQESEEPPPKKGRMQLSEDENH
FPGSDLMGSPFLGPHPHQPPFCLPFYVIPPSATAYLPMLEKCWYPTSVPVLYPGLNASTA
ALTSFMNPDKISAPLLMPQRLPSPLPPHPSIDSSALLQALKQIPPLNLETKD
Download sequence
Identical sequences ENSETEP00000004441 ENSETEP00000004441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]