SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000004622 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000004622
Domain Number 1 Region: 49-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000291
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 2 Region: 275-363
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000593
Family I set domains 0.022
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000004622
Domain Number - Region: 173-206
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0392
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000004622   Gene: ENSETEG00000005687   Transcript: ENSETET00000005684
Sequence length 415
Comment pep:novel genescaffold:TENREC:GeneScaffold_3448:80433:81680:1 gene:ENSETEG00000005687 transcript:ENSETET00000005684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAHATVLLWAWGSLLTFEIVEKENIFQKTPCPAFLMFDNAAYLTDMSFELPCHCKPEE
VLAVVWYHQKHLGSTHTQVLTDFDGRVLTEAAARVRVGSDMLARFSIRMFSLLVFRAQPE
DSGLYFCGTRKGDYFYAYDVDIQSSEGMVASFRDEGQEPFEDEYHGDLRVFTTFWEWTPC
DRCGVRGEQWRIGLCYLQSPDLSPRYRQTLPNAVSCGSQAVPRKLRARAKHHTPELLVRS
CLVSCERRQTVHLGLLAIFNYVSKAGRRPWVPQVPIQFHQQMLGHGLLISCPGARPEHAV
AWDKDRQQLYRTQYLKDVNRSMRVFIDHGNQLHIRFTQLSDRGIYYCWRQGVRVAGFRLA
VKTRGHYHASFSDPETRAVLQLILLGYALITATFATVHLCRCCCYFFRCCPNLSP
Download sequence
Identical sequences ENSETEP00000004622 ENSETEP00000004622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]