SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000005952 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000005952
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000615
Family Hairy Orange domain 0.00013
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000955
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000005952   Gene: ENSETEG00000007340   Transcript: ENSETET00000007339
Sequence length 333
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_3810:10679:20824:1 gene:ENSETEG00000007340 transcript:ENSETET00000007339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEETTSESDMDETIDVGSENNFSGQSTSSVIRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRMRLVSHLSTCASQREAAAMTSTMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHASESAPCRLSTNSEVPPVHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAHSFPLSFAGAFPMLPPNAAVAATAAV
SPSLAASAASSPQQMGSATNKPYRPWGTEVGAF
Download sequence
Identical sequences ENSETEP00000005952 ENSETEP00000005952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]