SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000006770 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000006770
Domain Number 1 Region: 709-887
Classification Level Classification E-value
Superfamily SPOC domain-like 1.8e-48
Family SPOC domain 0.0003
Further Details:      
 
Domain Number 2 Region: 413-493
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.43e-17
Family Canonical RBD 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000006770   Gene: ENSETEG00000008333   Transcript: ENSETET00000008332
Sequence length 889
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_1040:258392:261153:1 gene:ENSETEG00000008333 transcript:ENSETET00000008332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLSERDSSPSGRGSSSSAKRPRDSKLTEAAGXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLW
VGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGP
DRRLRVDFAKAEETRYPQQYQPSPLPVHYELLPDGYARHRHLDPDLRVRDRTPPHLLYSD
RDRTFLEGDWTSPAKSSDRRNSLEGYGRSVRSRSGERWGADGDRGAGKPWEERRKRRSLS
SDRGRATHSPYEERSRTKGGGQQLERGSERTPERSRKENHASEGAKDPGSNALSNSRHGA
EERGHHHHHEPADASHGKKTRDSERNHRTTEAEPKPPEEPKHEARKLKSLSEYAQTLRLG
WNGLLVLKNSCFSTSMHLLEGDQGVISGLLKDHSSGSKLTQLKIAQRLRLDQPKLDEVTR
RIKQGSPNGYAVLLATQATAGGPGAEGLPTVEPGLQRRLLRNLVSYLKQKQAAGVISLPV
GGSKGRDSTGMLYAFPPCDFSQQYLQAALRTLGRLEEEHMVVVIVRDAA
Download sequence
Identical sequences ENSETEP00000006770 ENSETEP00000006770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]