SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000007977 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000007977
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.83e-49
Family N-terminal domain of cbl (N-cbl) 0.00000362
Further Details:      
 
Domain Number 2 Region: 200-286
Classification Level Classification E-value
Superfamily SH2 domain 1.32e-46
Family SH2 domain 0.00000457
Further Details:      
 
Domain Number 3 Region: 293-370
Classification Level Classification E-value
Superfamily RING/U-box 1.3e-42
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 115-199
Classification Level Classification E-value
Superfamily EF-hand 6.35e-37
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000007977
Domain Number - Region: 864-909
Classification Level Classification E-value
Superfamily UBA-like 0.000112
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000007977   Gene: ENSETEG00000009820   Transcript: ENSETET00000009822
Sequence length 922
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_2413:3704:324135:-1 gene:ENSETEG00000009820 transcript:ENSETET00000009822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRLCQNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMK
KSKRAIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKA
DAAEFWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIF
TRLFQPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKHSTKPGSYIFRLSCTRLGQWA
IGYVTGDGNILQTIPHNKPLFQALIDGGREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVT
QEQYELYCEMGSTFQLCKICAENDKDIKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIK
GTEPIIVDPFDPRDDGSRCCSIIDPFGMPMLDLDDDDDREESLVMNRLANVRKCADRQNS
PVTSPASSPLSQRRKPHSDPLQIPHLILPPVPRDLIQKLVRSPCGSPTGPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPENRLSRHFHPAESVPSRDQPMPLEAWCPRDVFG
ADQWVGCRLLRCAPKPGMTASSTVNDRHGRVGPDQVLMRKHRRHDLSLEEAKVFSNGHLG
SEEYDVPPRLSPPLPAAALLPSIKCRGPLATPLSEKTRELVEDDDDEYNVPSSHPVCLNS
QPPHCHNVKPPVRSCDNGHCILNGTHSTSSEMKKSTIPELGIYLKRGVCDSASDPVPLPP
ARPATRDNPKHGSSFNRTPSDYDLLTPSLGEDAFDAIPPSLPPPPPPARHSLFEQSKPSG
SSSRPSSGQDLFLLPADPFFDPASGQVPLPPARRLPGEDVKSKRTSQDYGPLPSGSDGSQ
APARPPKPRPRRTAPEIHHRKPHGSEAAMENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences ENSETEP00000007977 ENSETEP00000007977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]