SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000009735 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000009735
Domain Number 1 Region: 1310-1386
Classification Level Classification E-value
Superfamily Immunoglobulin 3.82e-17
Family I set domains 0.0092
Further Details:      
 
Domain Number 2 Region: 924-998
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000137
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 707-760
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000196
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000654
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 571-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000288
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000458
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 1484-1515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000085
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 8 Region: 648-704
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000122
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 9 Region: 75-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 10 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 11 Region: 1428-1484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000009735
Domain Number - Region: 831-881
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000392
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000009735   Gene: ENSETEG00000011990   Transcript: ENSETET00000011993
Sequence length 1697
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_5379:667:268457:1 gene:ENSETEG00000011990 transcript:ENSETET00000011993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSWKSPRWLLTWMAFICSILLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXTSRNPRSDEEKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LDGTRCNADSLDMCISGICQAVGCDRQLGSKAKEDSCGLCAGDGSTCRLVRGQAKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGNKGDHSFNSPGVFVVENTTIEFQR
TSERQTFKIAGPLMADFIFKTRYTVARDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGEIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHLGEHVGGCNPPLKLHIKEECVIPIPCYKPKEK
SPVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQVREVKCRVLLTFTQT
DTELPEEECEGPPLPTERPCLLGACEDSPATRQPATAAQERDSVMTYDWEYSGFTPCTAT
CLGGHQEAIAVCIHIQTQQTVNDTLCNALHRPPAMSQACNTEPCLPRWHTGSWGPCSATC
GVGIQTRDVYCLHPGDSLAPPEACRVEKPHALQACNQFDCPPGWHIEDWQQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSVSCGVGI
QRRKQVCQRLTAKGRRVPLSEVMCRHLPGPPLVRACQMPACNKMKPATKTKLVEQGPQIL
GVQRIYIQTREEKRINLTVGSRAYLLPNTSVIIKCPVRRFHKPMIQWEKNGHCLQNSRRL
GITKSGSLKIHSLAAPDIGVYRCIAGAAQETVVLKLIGTDNRLIAPPVLREHRRVYPGME
HSQDNSLGATWHKMQQMRNNKNDLYLDDGQINSQPILRALLGHCSHSAGHTNSWELKNKQ
FEAAVKQGAYSMDTAQFEELIRNMSQLMETGEISDDLASQVIYQLVAELTKAQPTHVPWR
SIREEVPPAAQLRGEMGSVPPNSNARDSGKLTFRPKVPVLKRQSQPPEISFNKTIHSRIG
NTVFITKRTAVINILCDLATPSEVVYTWTKDGALLQPSAXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAPVILSVERNVTSPERTHLLAVVGGIVEAALRANVTI
QCPVKGVPQPSVTWLKRGGALQDNVSLLFNGSLLLQNVSLENEGTYICTATNTLGEARAA
SGLHVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSWKPGNWTHCSAT
CGHLGTSLQRPRCVAADGREVSQALCDHLPKPRAGFRRCNVRDCPARWLTSAWSECSVSC
GEGFRSRQVTCKRIRANGTVPSAMPRECAAKDRPLGKKPCSSRPCVPWAGEPENQCPGHC
MGRIMRVQQPLHTVCHQHNGSAARDANCDDRKRPTFRRNCSSGACDGCWHTGLWQLCTAA
CGRGFQARVECVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCADTAHYCLFVKHLH
LCAFDLYKHRCCHSRGG
Download sequence
Identical sequences ENSETEP00000009735 ENSETEP00000009735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]