SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000010054 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000010054
Domain Number 1 Region: 156-190,230-373
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-28
Family Phosphotyrosine-binding domain (PTB) 0.007
Further Details:      
 
Domain Number 2 Region: 933-1047
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.36e-23
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 3 Region: 14-155
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-18
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 
Domain Number 4 Region: 771-850
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000889
Family Ypt/Rab-GAP domain of gyp1p 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000010054   Gene: ENSETEG00000012397   Transcript: ENSETET00000012399
Sequence length 1163
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_534:858:216186:1 gene:ENSETEG00000012397 transcript:ENSETET00000012399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFMARKHAFPNEASVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSTSRKEPVSK
QVRLCVSPSGLRCEAEPGKSQPWDPLLCCSIFECQPQQVHKLIHNSYDPSYFACLVKEDA
ASQQSVCFVFKADDQTKVPEIISSIRQAGKVARQEERHCPSEFDDAFAKKFEVLFCGRVT
VAHKKAPPALIDECIEKFNRVSCSRRAGTCRPNSPRAGPASRAAAPGSRPMRKSFSQPGL
CSLAFRKEFQDGSLRGSRFFRSFEENDTENHLLGGHNVVQPTDMEENRTMLFTIGQSEVY
LISPDTKKVALEKNFKEISFCSQGIRHVDHFGFICRESSSSGGIHFVCYVFQCTNEALVD
EMMMTLEQAFTVAGHRTSKAPAQLCEGCPVQCLHKLCERIEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKLRPRNEQQENELIVSFLRSFYEEKQKEHVHIGEMKQASQVAAETVGS
ESPPRATRFRLDLLKSRAKRSLTESLESFLSRGNKARGLQDRAGSVDLDSSLSSAFSNAS
KEPAVCEREALPVLESSFRLLGSSDDLSSDSESHLSEESAQLSPQQGFRQRANTLSHFPP
ERQDPVEPAEASPAVSPRKLLRYHSVSTETPHEPKDLEPKANHPADASGTPMKTRRHSWR
QQIFLRVATPQKACDSPSRYEDYSELGELPPRSPLEPVCEDGPFGPAPEEKRRTPRELRE
LWQKAILQQILLLRMEKENQKLQASEHDLLNKRLKLDYEEITPCLREVTTVWEKMLSTPG
RSKTKFDMEKLHSAVGQGVPRHHRGEIWKFLAEQCHLRHQFPSKQRPRDTPYKELLKQLT
SQQHAILIDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQMYQLSRLLHDYHRDLHTHLEEQEIGP
SLYAAPFLTVFASQFPLGFVARVFNMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIV
DFIKNTLPNLGLVQMEKTISQVFEMDISKQLQAYEVEYHVLQEELIDSSPLSDNQRMDKL
EKTNSSLRKQNLDLLDQLQVANGRIQSLEATVKKLLTRESKLKQATLALELESALLQTLE
ELRQRSTKAGGVTDGGEPQPTTP
Download sequence
Identical sequences ENSETEP00000010054 ENSETEP00000010054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]