SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000010939 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000010939
Domain Number 1 Region: 1244-1334
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.75e-20
Family BCR-homology GTPase activation domain (BH-domain) 0.00082
Further Details:      
 
Domain Number 2 Region: 1012-1062
Classification Level Classification E-value
Superfamily PH domain-like 0.000000315
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 45-123
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000956
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000010939   Gene: ENSETEG00000013486   Transcript: ENSETET00000013488
Sequence length 1935
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_1950:7402:144232:-1 gene:ENSETEG00000013486 transcript:ENSETET00000013488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGLPEGDGDQLKACVSPTCEVSKTKDGKEQSETVSPSEDETFSWPGPKTVMLKRT
SQGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGNQRNHLEPMDTIFVKQVKEGGPAFEA
GLCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQFTKDATALA
YSQDAYLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASSRSLEPSGFLLNSGKYSGHSE
GISGNRPQLAEVSSVPVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLR
AASQSTADYNQVVPHRMALQVRRRSTSHDRGPQPVQVRQRSVSQERLEDAVLMKCCPRSA
SQGALTSPPVSFSTHRTRSWDYIDGQGEAGENVHSGSQTPDSNGERKQTYKWSGFTEQDD
RRGICERPRQQEIHKSFRGSSFTVAPSMVHSDSRRIGGRGMGSASQLKKIPPDLKALQSS
RNFQTSCGMPLPRGVAQDKSPLVKVRSNSLKAPSSFVPKPSFSSNSFVSIKDQRPVNHLH
QNSLLNQQTLLRTESTPDHPVETAKPPSLSGASAKLLPLTSETSGSSDFELSVVRRNQDL
NLPEAEIPQSSVLDNKETVVLREKPPSGRQTPQPLRHQSYILAVNDQDTGSDTTCWLPND
ARREVHIKRMEERKASASSPPSDSLASIPFIDEPTSPSIDHDLAHIPASAVISASASQVP
SIATVLPSLTTSAPLIRRQLSHDHESVGPPSLDGQPSSKTERSKSYDEGLDDYREDAKLS
FKPVSSLKRIKIADSQKSCTDSVSRKDSASKVFSDAAKEGWLHFRPLVTDKGKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDVFRLTTSDC
ECLFQAEDRDDMLAWIKTIQDSSNLNEKDTGVTNTDLISRRIKEYNTLMSKAEQLPKTPR
QSLSIRQTLLGAKSEAKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFE
KKPTATGTFGVRLDDCPPAHTNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYADFIEANRKEDPLERL
KTLKRLIHDLPEHHFETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGLTLVRTSEDNMTH
MVTMPDQYTSVELIHHDFFTENGAEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGVSPG
DVSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNV
FFKKEHAPQGQDDRGGEPKKEGAMAGRKSSANKDAGTTHEKASLPCTDGAPPGESPTGSG
HLTRPRESPRSLATPKSSPFAETGSDSGTLLSLSSQASQARCGAPRKPTSPETKPGEFVV
HVGPATSDDPTAYLTCLDSSRLSPEVQSVAESKGDEADDERSELISEGRPVETDSESEFP
LSPTALTAERPPRGGAAGAARASRRNSEGSEVSGTEGSLTPSLDSRRQLFSSHKLIECDT
LSRRKSARLRSDSGLLADAKTERDAPSVTTKVLDVMKRGKSTGSLLTPARSEPEKQEPTW
KTKIADRLKLRPLRAPADDMFGVGDPRLSGGAAKRKHIKRRHTLGGHRDAADMSVLSFWK
AQEQSSEREAELSAVNRLKPKCSAQDLSIADWLARERLRPGASDPRRGDLGDPRLEKAPS
TFPAPAADGAQPFPPQARSSPTSSAATNRTRRPTAPPPSPDHINGESFQNAGCASKAQPH
ELSEAPGSTLHPCLE
Download sequence
Identical sequences ENSETEP00000010939 ENSETEP00000010939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]