SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000011315 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000011315
Domain Number 1 Region: 556-743
Classification Level Classification E-value
Superfamily Bet v1-like 7.56e-34
Family STAR domain 0.015
Further Details:      
 
Domain Number 2 Region: 84-244
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-28
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000011315   Gene: ENSETEG00000013944   Transcript: ENSETET00000013944
Sequence length 752
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_8284:69998:194238:-1 gene:ENSETEG00000013944 transcript:ENSETET00000013944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHGYAPTHTSFFSTPPTSLPVVTRESGRGSSSGGNAGRNAGVTTTAAADGWKSRLPSPL
VLLPRSARCQARRRRRRGGHTSSSRLLPPAPERALFPSPSPDPSPRGLRAFPGAPQGAEA
ALLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNT
LSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDA
IEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDIL
CRQVDTLQKFFDACADAVSKDELQRDKVVEDVEDDFPTTRSDGDFLHNTNGNKEKIFHVP
PKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRLDKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXEGPNSLINEEEFFDAVEAALDRQDKIEEQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXPYSRSSSMSSIDLVSASDDVHRFSSQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWE
TTIENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPAS
VLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences ENSETEP00000011315 ENSETEP00000011315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]