SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000013036 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000013036
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily PH domain-like 7.69e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000533
Further Details:      
 
Domain Number 2 Region: 207-277
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.4e-26
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000161
Further Details:      
 
Domain Number 3 Region: 397-455
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000418
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000013036   Gene: ENSETEG00000016070   Transcript: ENSETET00000016072
Sequence length 467
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_183:7:7375:1 gene:ENSETEG00000016070 transcript:ENSETET00000016072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEMLGRKCWTLATAVVQLYLALPPGAEHWTKEYVGAVCFVKDNPQKSYFIRLYGLQAGRM
LWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEGEAQVFRALVQEKIQKSNQRQSGD
RRQLPPPPAPANEERRGGLPPLPPHPGGDLGGTPAGSLSLGLVTVDIQNSDITSSRYRGL
SAPGSGSVDKKRSWKKKIRKVDIGALSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAG
ISEAQLTDAETSKLIYDFIEDQGGLEAGGQEMRRQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGALLDQIRQRIQLNKTPAVAENSA
LQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences ENSETEP00000013036 ENSETEP00000013036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]