SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000013797 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000013797
Domain Number 1 Region: 332-462,762-823,852-940
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.49e-38
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 2 Region: 233-302
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000435
Further Details:      
 
Domain Number 3 Region: 173-230
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000329
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 
Domain Number 4 Region: 107-187
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000391
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 5 Region: 1140-1185
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000729
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000013797   Gene: ENSETEG00000017001   Transcript: ENSETET00000017002
Sequence length 1185
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_1540:78989:233996:1 gene:ENSETEG00000017001 transcript:ENSETET00000017002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAGGQHHPPSAAGGVAAAGAGAAVPSAAASVGPGEDSSDSEAEQEGPQKLIRKVSTSG
QLRTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLIFDEVDLSDASVAEAS
TKNANNSFTIITPFRRLMLADHRKEMEDWISCLKSVQTRETYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLSSIGKDILED
EDGVAMPHQWLEGNLPVSAKCVVCDKTCGSVLRLQDWKCLWCKAMVHTACKDLYHPVCPL
GQCKVSVIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPYLGLRLFHKFDNFRILVCGGDGSVGWVLSEIDKLNLIKQATCKVGVLPLG
TGNDLARVLGWGGSCDDDTQLPQILEKLERASTKMLDXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXMTIYEDSVETHLQTILSADERTVILSSANILCETVKDFVAKIEKEYGKALESPD
DADMASKCSVLNEKLGQLLQAVQKDHPAPVCGLIAEEDPAEFSSEESLRDTKEHLADSAT
PSQKAAKPTLIMLRANSLKKAVRQVIEQVEKATDDHTAPPCGPCPQSPECDPPETADPKE
ECREDEAQEPGPVKTAPRSPDGRASQTLSQTDSSSSGPPVAAGKESLPVLNTRIICPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGYTEKCVMNNYFGIGLDAKISL
EFNNKREEHPEKCRSRTKNFMWYGVLGTRELLQRSYKNLEQRVQLEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXIFAAPSFDDKILEVVAVFDSVQMAVSRVIKLQHHRIAQ
CRAVKITIFGDEGLPVQVDGEAWVQLLGIIKIVHKNAQMLTXXXAFESTLKSWEDKQKCD
SGKPVLRTHLYIHHAVDLATEEASQMQLCFQAAEELITRICDAATIHCLLEQELAHAVNA
CSHALNKANPKYPESLTRDVATEIAVNVKALYNETESLLVGRVPLQLESPHEERVSDALH
SVELELQKLTEIPWLYYIFHQNEDEGPPMDCTKRNNRSTVFRIVPKLKKEKGPKQKASSQ
PVQKWGTEEVAAWLDLLHLGEYKEIFIRHDIRGAELLHLERLDLK
Download sequence
Identical sequences ENSETEP00000013797 ENSETEP00000013797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]