SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000013892 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000013892
Domain Number 1 Region: 227-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.4e-37
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 80-150
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000024
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000013892   Gene: ENSETEG00000017123   Transcript: ENSETET00000017122
Sequence length 420
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_8635:3543:5699:-1 gene:ENSETEG00000017123 transcript:ENSETET00000017122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRWGESVNPRPGGEEAAIPGEGGKAQKVNAGGGERAIESPSGKAGLPSAPSEAAAVVAQG
VAPRHRLPMEAPELGPGLVERLEQLATCPLCGGPFEDPVLLACEHSFCRACLARRWGPPP
PPGAQETPPGCPSCGHPCPRRSLRSNVRLAVEVRISRSLCEKLAAPGARTGRRRGGRIPT
MGCLDPHEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTLDPRTAHRR
LLVSSDGRSVRLAPPGTPAPPDSPSRFDQLPAVLGAQSFGAGRHCWEVETAEPASCGNSS
GEDEGDAESCYALGAAGESVRRKGRVGLCPAGAVWAVEGRGGRLWALTTPEPTPLGGAGP
PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQAPGPLGERVFPLLCTRDPRAPLRIVPAEG
Download sequence
Identical sequences ENSETEP00000013892 ENSETEP00000013892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]