SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000015232 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000015232
Domain Number 1 Region: 201-374
Classification Level Classification E-value
Superfamily Subtilisin-like 1.17e-29
Family Subtilases 0.00000697
Further Details:      
 
Domain Number 2 Region: 564-615
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000302
Family Proprotein convertase P-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000204
Family Prohormone convertase 1 pro-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000015232   Gene: ENSETEG00000018743   Transcript: ENSETET00000018744
Sequence length 755
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_4970:74327:105706:-1 gene:ENSETEG00000018743 transcript:ENSETET00000018744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGRPEVPHLEAPLGLPSCPWLQLAGLFLLVPWVMGLTGTEGPAALSPGGLSWAVHLRS
PEGEGKEETLEQQAEALAQAAGLVNAGRIGELHGHYLFVQPAGPKQDQQGEAIRQQAEAV
LAGHEAVHWHSEQRLLKRAKRSVHFNDPKYPQQWHLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSPEGSYDLNSNDPDPMPHPDVENDNHHGTRCAGEIAAVP
NNSFCAVGVAYGSRIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWGPDDDGKTVDGP
HHLGKAALQHGVMAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGTVDEEGRM
PFYAEECASMLAVTFSGGDKMLRSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVWT
SVPYLASYVSPVLKENQAIPLSPRALEVQWNXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXDPNGFNDWTFSTVRCWGESARGTYRLVIRDIGDEPV
PAGLLWRWQLTLFGSVWSAVDIRDRQRLLERAMSGKYLQDGFSLPCPPGLKIPEEDGYTI
TPNTLKTLVLVGCFTIFWTAYYMLEVCLSHQRVASRAGGRHGACPRPHCSRKAREEGTEL
ESVPLCASKDPGEVEAEGGSPAAPSNPLVPDLLDQ
Download sequence
Identical sequences ENSETEP00000015232 ENSETEP00000015232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]