SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000015263 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000015263
Domain Number 1 Region: 685-846
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 12-84
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000952
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 516-590
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000012
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 4 Region: 262-298
Classification Level Classification E-value
Superfamily WW domain 0.000000111
Family WW domain 0.0023
Further Details:      
 
Domain Number 5 Region: 363-392
Classification Level Classification E-value
Superfamily WW domain 0.0000163
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000015263   Gene: ENSETEG00000018784   Transcript: ENSETET00000018784
Sequence length 847
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_6190:4760:241227:-1 gene:ENSETEG00000018784 transcript:ENSETET00000018784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKMADRSGKIVPGQAYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPEENSK
TFYVPAQYVKEVTRKALMPPVKQAVGLPNHSMKMIQSLHLQKSTENVNKLPELSSFGKSS
SSVQGTGIIRDANQNFGPNCSPGQTLGLSLDLTHNNGKFNSDSHSPKVPSQNRTRLFGHF
PCPEFLDIEKTSFSQEQSCDSAGESSERIHQDSESGDELSSSSTEQIRATTPPNQGRADS
PVYANLQELKISQSALPPLPGSPAIQIIGEWETHKDISGRFYYYNRGTQERTWKPPRWTR
DATLTKGDFHSAGDQELLSSEENYHRICYSQSDSQCGSPPRGWSEELDERGHTLYTSDYT
NEKWLKHVDDQGRQYYYSADGSRSEWELPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXESPTASKPSFPENESPPPSSPKHQDTASGLKGQEKYGLLNVTKITENG
KKVRXXXXXXXXXXXXXXXXXXXXXXXXXXXFGSNQSKPEFTVDLKGAVIEMAPKDKSSK
KNVFELKTRHGTELLIQSDNETVINDWFKVLSNTISNQAAETEEGPEEEAPDSPGIEKHD
KEKDHKDPKKLRSMKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXLDIDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSK
WEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVAAVKDLIRQLPKPNQDT
MQILFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLE
LSAIFGR
Download sequence
Identical sequences ENSETEP00000015263 ENSETEP00000015263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]