SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000015858 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000015858
Domain Number 1 Region: 349-425
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.98e-19
Family PCI domain (PINT motif) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000015858
Domain Number - Region: 252-354
Classification Level Classification E-value
Superfamily TPR-like 0.000455
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Domain Number - Region: 69-216
Classification Level Classification E-value
Superfamily TROVE domain-like 0.0144
Family TROVE domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000015858   Gene: ENSETEG00000019523   Transcript: ENSETET00000019523
Sequence length 453
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_4282:188727:217621:-1 gene:ENSETEG00000019523 transcript:ENSETET00000019523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLEL
EGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYIS
TSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILR
QLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLI
MGVIRGKFECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG
INPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEEL
LRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLE
LDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Download sequence
Identical sequences L8IUU2
ENSETEP00000015858 ENSMMUP00000012877 ENSMMUP00000012877 9544.ENSMMUP00000012877 ENSETEP00000015858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]