SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000016283 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000016283
Domain Number 1 Region: 38-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.28e-34
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 629-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-18
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-17
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 516-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000428
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 374-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000225
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 211-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000235
Family KRAB domain (Kruppel-associated box) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000016283   Gene: ENSETEG00000020049   Transcript: ENSETET00000020049
Sequence length 683
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_58:678:10547:1 gene:ENSETEG00000020049 transcript:ENSETET00000020049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGPGSQEREGLLIVKLEEDCAWSQELPPPDAGSRAQSAHLRFRRYRFQEAGGPREALS
RLQELCHEWLRPELLTKEQILDLLVLEQFLTILPPEIQSRVQELHPESGEEAVTLVEDLQ
KELERLRQQVTNHGRGTAVLLEEPLPLETARASPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNTEDKEMTGPQLPESVEDMAATYISQEWGQQEPSKKL
LSRDSVQESYENVHSLESLIPHQEAPSTPVEQDKKSLDPRTQSWKEILSPRSLPAGEEKF
ENQEETAQLVAPENTHPLELPGQAKGEVPWSPEQGQPQDRSEGHWDPLPENQMEQSLVGA
TNCRELGRTKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCGDIFGGSPH
FLSLHRAHLGEEAHKCLECGKSFSQHTHLTRHQRTHTGEKPYQCTVCGKSFSCNSNLHRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHNGERPYKCPECGKSFSRSSHLVIHERTH
ERERLYPFSECGESVNDCTPFLTNHRTPKVEKKLFKCLTCGKSFGQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CSECGESFSRSSRLVSHQRTHTG
Download sequence
Identical sequences ENSETEP00000016283 ENSETEP00000016283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]