SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000016313 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000016313
Domain Number 1 Region: 14-118
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 462-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-19
Family Laminin G-like module 0.0087
Further Details:      
 
Domain Number 3 Region: 123-212
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000628
Family Cadherin 0.0046
Further Details:      
 
Domain Number 4 Region: 673-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 5 Region: 635-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.02
Further Details:      
 
Domain Number 6 Region: 598-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family EGF-type module 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000016313   Gene: ENSETEG00000020083   Transcript: ENSETET00000020083
Sequence length 1162
Comment pep:novel genescaffold:TENREC:GeneScaffold_6191:269919:348002:1 gene:ENSETEG00000020083 transcript:ENSETET00000020083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFS
ILAGNEEEAFLLDPHGILRSAVVFRHTESLEYVLCVQAKDSGNPQQVSHSYIRVRVIEES
VHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDVYDVLTFALKSEQKSLFKVNSHDGKI
IALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHAMLQNTVTLRFENVSPEDFVGLH
MLGFRRTLRNAVLSQKQDSLHIISIQPVAGTNQLDMLFAVEMHSREFYKPAYLIQKLSNA
RRHLENVMRISAILEKNCSGLDCQEQHCEQSLSLDSHALMTYSTARISFVCPRFYHNVRC
TCNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKSISXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVDGKLWFQLDCGSGPGIL
GISGRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSAESTIYFGALVQAD
NIRSLTDTRVTQVLSGFQGCLDSVVLNAHELPLQNKRSSFAEVVGLTELKLGCVLYPDAC
ARAPCQHGGSCTGLPSGGYQCSCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNAFICN
CKDGLTGVTCEEDINECEREECENGGACVNLFGSFLCNCTPGYVGQYCGLRPVVVPDIQA
GHSYVGKEELIGIAVVLFVIFILIILFIVFRKKVFRKNYSRNNITLVQDPATAALLNKSN
GIPFRNLRGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKIVDGLGGEHQEMTTFH
PESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDAGTDNKGVDDSGEVTCFAG
SNKGSNSEVQSLSSFQSDSGDDNASIVTVIQLVNNVVDNIENEVSVMDQGQNYNRAYHWD
TSDWMPGARLSDIEEVPTHENQDGGSAHQGGPRELESDYYLGGYDIDSEYPPPHEEEFLS
QDQLPPPLPEDFADQYEALPPSQPVSLAGTLSPGCRRRPQFHPSQYLPPHSFPNETDLVG
PPAGCEFSTFAVNLNQGSEAARPADGVSLSLHNSRGTSSSDVSANCGFDESEVAMSDYES
VGELSLASLHIPFMETQHQTQV
Download sequence
Identical sequences ENSETEP00000016313 ENSETEP00000016313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]