SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000016582 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000016582
Domain Number 1 Region: 463-576
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-31
Family SH2 domain 0.000000683
Further Details:      
 
Domain Number 2 Region: 147-239
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.99e-28
Family Ras-binding domain, RBD 0.00018
Further Details:      
 
Domain Number 3 Region: 275-351
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000959
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000016582   Gene: ENSETEG00000020405   Transcript: ENSETET00000020405
Sequence length 579
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_1829:6251:277982:-1 gene:ENSETEG00000020405 transcript:ENSETET00000020405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKVEQTSPHSQRDLAEPGFPAQTHQLASHQEDDVDLEALVNDMNSSFESLYSTCSMQSET
VPLLQNGQHARNPLLTLGTRALQPQASPRQKVQRSQPVHILAVRRLQEEDQQFRTSSLPA
IPNPFPELCTAGSSPVLSPGSLPPSQCTTKQNVKVFSEDGTCKVMEFLADMTARDLCQLL
IYKSHCVDDSSWTLVEHHPHLGLERCLEDHELVVQVERTMASESKFLFRKNYAKYEFFKN
PMNFFPEQMVTWCQQSNGSIPQTQLLQNFLNSSSCPEIQGFLHVKELGRKSWKKLYVCLR
RSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYSAPTDHDFCIKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXYGRLLYQNYRIPQQRKALLSPFSTPVRSVSENSLVAM
DFSGQTGRVIENPVEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFH
GRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQMFF
SLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences ENSETEP00000016582 ENSETEP00000016582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]