SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188532508|ref|YP_001906305.1| from Erwinia tasmaniensis Et1/99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188532508|ref|YP_001906305.1|
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-49
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 293-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.15e-46
Family Ribonuclease PH domain 1-like 0.0000156
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.33e-30
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 450-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 608-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-22
Family Cold shock DNA-binding domain-like 0.0000246
Further Details:      
 
Domain Number 6 Region: 238-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.02e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0014
Further Details:      
 
Domain Number 7 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188532508|ref|YP_001906305.1|
Sequence length 710
Comment polynucleotide phosphorylase/polyadenylase [Erwinia tasmaniensis Et1/99]
Sequence
MLNPIVQKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQKKAKPGQGFFPLT
VNYQERTYAAGRIPGSFFRREGRPSEGETLTSRLIDRPIRPLFPEGFVNEVQVIATVVSV
NPQVNPDIVAMIGASAALALSGLPFNGPIGAARVGYLNDQYVLNPTSDELKESKLDLVVA
GTKGAVLMVESEAELLSEDQMLGAVVFGHDQQQIVIDNINALVAEAGKPRWDWQPEAVNE
ALRSRITALAESRLSDAYRITEKQERYAQVDVIKSETSAALLAEDEALDAAEISDLLHAL
EKDVVRSRILRGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTAR
DAQNLDELMGERTDNFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLAVMPKGDA
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKDENNFVVLSD
ILGDEDHLGDMDFKVAGSREGITALQMDIKIEGITREIMQVALNQAKGARLHILGVMEQA
ISGPRGDISQFAPRIHTIKISVDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGDKAKFAIRRIEEITAEIEVGRIYNGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVPVKVLEVDRQGRVRLSIKEAGEQAQPEAEAVPAAPEAE
Download sequence
Identical sequences B2VGN7
gi|188532508|ref|YP_001906305.1| WP_012440112.1.58220 465817.ETA_03510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]