SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000008 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000008
Domain Number 1 Region: 29-134
Classification Level Classification E-value
Superfamily FKBP-like 1.51e-34
Family FKBP immunophilin/proline isomerase 0.00000142
Further Details:      
 
Domain Number 2 Region: 254-410
Classification Level Classification E-value
Superfamily TPR-like 3.32e-33
Family Tetratricopeptide repeat (TPR) 0.000000196
Further Details:      
 
Domain Number 3 Region: 138-253
Classification Level Classification E-value
Superfamily FKBP-like 1.18e-27
Family FKBP immunophilin/proline isomerase 0.00000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000008   Gene: ENSEEUG00000000012   Transcript: ENSEEUT00000000011
Sequence length 420
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_310668:3825:11254:-1 gene:ENSEEUG00000000012 transcript:ENSEEUT00000000011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEEMKAESGAQPAPLPLDGVDISPKQDRGVLKVIKREGTGSEMPMIGDRVFVHYTGWL
LDGTKFDSSLDRKDKFSFDLGKGVVIAWDIAVSTMKVGEVCHITCKPEYYGSGSPPNIPP
NATLVFEVELFEFKGEDLTEEEDGGIIRRIRSRGEGYAKPNEGAIVEIALEGYFKDQVFD
QRELRFEVGEGESLDLPCGLEKAIQRMEKGEKAIVYLKPSYAFGSAGKEKFQIPAGAELK
YEVYLKSFEKAKESWEMSSEEKLEQSSMVKERGTAYFKEGRYKQASLQYKKIVSWLEYES
SFSGEDSQRAQSLRLASYLNLAMCHLKLQAYSAAIENCNKALELDSNNEKGLFRRGEAHL
AMNDFDLARADFQKVLQLYPSNKAARAQLVLCQQRIRKQLAREKKLYANMFERLAEEDTK
Download sequence
Identical sequences ENSEEUP00000000008 ENSEEUP00000000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]