SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000029 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000029
Domain Number 1 Region: 263-363
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-27
Family SH2 domain 0.00034
Further Details:      
 
Domain Number 2 Region: 187-289
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-22
Family SH3-domain 0.0000774
Further Details:      
 
Domain Number 3 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 4 Region: 115-170
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-17
Family SH3-domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000029   Gene: ENSEEUG00000000033   Transcript: ENSEEUT00000000033
Sequence length 376
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_281000:1214:15654:1 gene:ENSEEUG00000000033 transcript:ENSEEUT00000000033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAA
VVNNLSTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGL
VPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGH
EGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPI
FTSEQGEKLYLIKHLS
Download sequence
Identical sequences ENSEEUP00000000029 ENSEEUP00000000029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]