SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000078 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000078
Domain Number 1 Region: 614-782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-43
Family SPRY domain 0.0033
Further Details:      
 
Domain Number 2 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000068
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 4 Region: 473-530
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000022
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000078
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0262
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000078   Gene: ENSEEUG00000000088   Transcript: ENSEEUT00000000088
Sequence length 793
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3590:124128:258035:-1 gene:ENSEEUG00000000088 transcript:ENSEEUT00000000088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFVSAPTTPCQKSPYGVRVFPPAMPPPATHLSPALAPV
PRNSCITCSQCHRSLMLDDRGLRVFPKNRVLERVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILELDDGNG
GQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSQYSKTLVLQTSEDTDSEEQTLP
FPVPSERLPLRRMSPFSSTLNLQPSFPGRSYFDLRSSPHQLSLHSSLQSLNAPXXXXXXX
XXXXXXXXXIDIKKLLAVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSRG
VHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRT
EGGITKGATIGVLLDLNRKTLTFFINDEQQGPIAFENVEGLFFPAVSLNRNVQVRAKSWG
EHPWVGPPDLRAK
Download sequence
Identical sequences ENSEEUP00000000078 ENSEEUP00000000078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]